Placeholder image of a protein
Icon representing a puzzle

2353: Electron Density Reconstruction 57 (with DNA!)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 12, 2023
Expires
Max points
100
Description

This puzzle is a bit different than previous Reconstruction puzzles. Like others, the structure of this protein has already been solved and published, and close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The difference is that in addition to a protein in this puzzle, the protein is bound to DNA! So we're curious if Foldit players can improve both the protein and the DNA using the electron density. Not every tool that works well with proteins also works with DNA, so this might take a bit more time to figure out strategy.

Sequence
Protein: MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK DNA: GTGATCGC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 24,858
  2. Avatar for Contenders 2. Contenders 70 pts. 24,834
  3. Avatar for Go Science 3. Go Science 47 pts. 24,829
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 24,763
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 24,655
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 24,325
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 24,232
  8. Avatar for Belgium 8. Belgium 4 pts. 23,997
  9. Avatar for Australia 9. Australia 2 pts. 23,923
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 23,917

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 24,858
  2. Avatar for Galaxie 2. Galaxie Lv 1 95 pts. 24,851
  3. Avatar for MicElephant 3. MicElephant Lv 1 89 pts. 24,833
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 84 pts. 24,829
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 79 pts. 24,823
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 75 pts. 24,807
  7. Avatar for gmn 7. gmn Lv 1 70 pts. 24,794
  8. Avatar for BootsMcGraw 8. BootsMcGraw Lv 1 66 pts. 24,790
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 62 pts. 24,763
  10. Avatar for guineapig 10. guineapig Lv 1 58 pts. 24,733

Comments


rosie4loop Lv 1

For a high resolution structure like this, water densities are visible. Those perfect spherical densities in the map could be a water oxygen. Some of them are within hbond distance that could contribute to protein structure stability or DNA interaction.

Probably challenging at this stage for Foldit to handle this, though.

rosie4loop Lv 1

For a high resolution structure like this, water densities are visible. Those perfect spherical densities in the map could be a water oxygen. Some of them are within hbond distance that could contribute to protein structure stability or DNA interaction.

Probably challenging at this stage for Foldit to handle this, though.