Placeholder image of a protein
Icon representing a puzzle

2353: Electron Density Reconstruction 57 (with DNA!)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 12, 2023
Expires
Max points
100
Description

This puzzle is a bit different than previous Reconstruction puzzles. Like others, the structure of this protein has already been solved and published, and close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The difference is that in addition to a protein in this puzzle, the protein is bound to DNA! So we're curious if Foldit players can improve both the protein and the DNA using the electron density. Not every tool that works well with proteins also works with DNA, so this might take a bit more time to figure out strategy.

Sequence
Protein: MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK DNA: GTGATCGC

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 23,571
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 23,361
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 21,599
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 19,062
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 16,476

  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 54 pts. 24,686
  2. Avatar for fpc 12. fpc Lv 1 51 pts. 24,655
  3. Avatar for Steven Pletsch 13. Steven Pletsch Lv 1 48 pts. 24,652
  4. Avatar for alcor29 14. alcor29 Lv 1 45 pts. 24,621
  5. Avatar for blazegeek 15. blazegeek Lv 1 42 pts. 24,603
  6. Avatar for georg137 16. georg137 Lv 1 39 pts. 24,537
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 36 pts. 24,531
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 34 pts. 24,528
  9. Avatar for BackBuffer 19. BackBuffer Lv 1 31 pts. 24,523
  10. Avatar for akaaka 20. akaaka Lv 1 29 pts. 24,522

Comments


rosie4loop Lv 1

For a high resolution structure like this, water densities are visible. Those perfect spherical densities in the map could be a water oxygen. Some of them are within hbond distance that could contribute to protein structure stability or DNA interaction.

Probably challenging at this stage for Foldit to handle this, though.

rosie4loop Lv 1

For a high resolution structure like this, water densities are visible. Those perfect spherical densities in the map could be a water oxygen. Some of them are within hbond distance that could contribute to protein structure stability or DNA interaction.

Probably challenging at this stage for Foldit to handle this, though.