Placeholder image of a protein
Icon representing a puzzle

2353: Electron Density Reconstruction 57 (with DNA!)

Closed since over 2 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 12, 2023
Expires
Max points
100
Description

This puzzle is a bit different than previous Reconstruction puzzles. Like others, the structure of this protein has already been solved and published, and close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The difference is that in addition to a protein in this puzzle, the protein is bound to DNA! So we're curious if Foldit players can improve both the protein and the DNA using the electron density. Not every tool that works well with proteins also works with DNA, so this might take a bit more time to figure out strategy.

Sequence
Protein: MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK DNA: GTGATCGC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 24,858
  2. Avatar for Contenders 2. Contenders 70 pts. 24,834
  3. Avatar for Go Science 3. Go Science 47 pts. 24,829
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 24,763
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 24,655
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 24,325
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 24,232
  8. Avatar for Belgium 8. Belgium 4 pts. 23,997
  9. Avatar for Australia 9. Australia 2 pts. 23,923
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 23,917

  1. Avatar for jdmclure 61. jdmclure Lv 1 1 pt. 21,410
  2. Avatar for Diegogoogle 62. Diegogoogle Lv 1 1 pt. 21,227
  3. Avatar for abiogenesis 63. abiogenesis Lv 1 1 pt. 21,194
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 21,173
  5. Avatar for heyubob 65. heyubob Lv 1 1 pt. 21,171
  6. Avatar for Yechan Kwon 66. Yechan Kwon Lv 1 1 pt. 21,163
  7. Avatar for Merf 67. Merf Lv 1 1 pt. 21,158
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 21,156
  9. Avatar for futsall 69. futsall Lv 1 1 pt. 21,155
  10. Avatar for harvardman 70. harvardman Lv 1 1 pt. 21,152

Comments


Artoria2e5 Lv 1

PDB-REDO entry says that the rotamers are probably very bad; we can shake that out. The handful of rama issues are probably best idealized or remixed out. Clashes (bumps) are not too bad.

rosie4loop Lv 1

For a high resolution structure like this, water densities are visible. Those perfect spherical densities in the map could be a water oxygen. Some of them are within hbond distance that could contribute to protein structure stability or DNA interaction.

Probably challenging at this stage for Foldit to handle this, though.

rmoretti Staff Lv 1

How best to handle waters in these electron density puzzles is something we're currently discussing. For best results, they need to get added back in. We may eventually implement tools to allow players to add/remove waters, but you're correct that it's challenging to get Foldit to handle waters properly. Right now I believe the approach is to add them back in with a post-processing step.