Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600
  1. Avatar for Trajan464 41. Trajan464 Lv 1 3 pts. 23,030
  2. Avatar for RichGuilmain 42. RichGuilmain Lv 1 3 pts. 23,028
  3. Avatar for zbp 43. zbp Lv 1 2 pts. 23,004
  4. Avatar for roarshock 44. roarshock Lv 1 2 pts. 22,982
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 22,932
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 2 pts. 22,902
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 22,807
  8. Avatar for Arne Heessels 48. Arne Heessels Lv 1 1 pt. 22,689
  9. Avatar for pfirth 49. pfirth Lv 1 1 pt. 22,614
  10. Avatar for ivalnic123 50. ivalnic123 Lv 1 1 pt. 22,583

Comments