Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 23,684
  2. Avatar for Go Science 2. Go Science 70 pts. 23,665
  3. Avatar for Contenders 3. Contenders 47 pts. 23,598
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,546
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 23,531
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 23,478
  7. Avatar for Australia 7. Australia 7 pts. 23,463
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 23,448
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 23,220
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 23,194
  1. Avatar for Trajan464 41. Trajan464 Lv 1 3 pts. 23,030
  2. Avatar for RichGuilmain 42. RichGuilmain Lv 1 3 pts. 23,028
  3. Avatar for zbp 43. zbp Lv 1 2 pts. 23,004
  4. Avatar for roarshock 44. roarshock Lv 1 2 pts. 22,982
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 22,932
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 2 pts. 22,902
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 22,807
  8. Avatar for Arne Heessels 48. Arne Heessels Lv 1 1 pt. 22,689
  9. Avatar for pfirth 49. pfirth Lv 1 1 pt. 22,614
  10. Avatar for ivalnic123 50. ivalnic123 Lv 1 1 pt. 22,583

Comments