Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 23,183
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 22,509
  3. Avatar for VeFold 13. VeFold 1 pt. 22,509
  4. Avatar for BiOHS18 14. BiOHS18 1 pt. 15,835
  5. Avatar for Cancer Blasters! 15. Cancer Blasters! 1 pt. 15,600
  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 1 pt. 22,245
  2. Avatar for Mozdzierz 62. Mozdzierz Lv 1 1 pt. 22,215
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 22,205
  4. Avatar for Yechan Kwon 64. Yechan Kwon Lv 1 1 pt. 22,196
  5. Avatar for jdmclure 65. jdmclure Lv 1 1 pt. 22,181
  6. Avatar for loganthatisweird 66. loganthatisweird Lv 1 1 pt. 22,166
  7. Avatar for CAN1958 67. CAN1958 Lv 1 1 pt. 22,142
  8. Avatar for TheFandomNerd 68. TheFandomNerd Lv 1 1 pt. 22,107
  9. Avatar for futsall 69. futsall Lv 1 1 pt. 22,101
  10. Avatar for osc 70. osc Lv 1 1 pt. 21,988

Comments