Placeholder image of a protein
Icon representing a puzzle

2356: Electron Density Reconstruction 58

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two copies of the same protein chain in this structure.

Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 23,684
  2. Avatar for Go Science 2. Go Science 70 pts. 23,665
  3. Avatar for Contenders 3. Contenders 47 pts. 23,598
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,546
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 23,531
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 23,478
  7. Avatar for Australia 7. Australia 7 pts. 23,463
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 23,448
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 23,220
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 23,194
  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 1 pt. 22,245
  2. Avatar for Mozdzierz 62. Mozdzierz Lv 1 1 pt. 22,215
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 22,205
  4. Avatar for Yechan Kwon 64. Yechan Kwon Lv 1 1 pt. 22,196
  5. Avatar for jdmclure 65. jdmclure Lv 1 1 pt. 22,181
  6. Avatar for loganthatisweird 66. loganthatisweird Lv 1 1 pt. 22,166
  7. Avatar for CAN1958 67. CAN1958 Lv 1 1 pt. 22,142
  8. Avatar for TheFandomNerd 68. TheFandomNerd Lv 1 1 pt. 22,107
  9. Avatar for futsall 69. futsall Lv 1 1 pt. 22,101
  10. Avatar for osc 70. osc Lv 1 1 pt. 21,988

Comments