Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,232
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,958
  3. Avatar for Belgium 13. Belgium 1 pt. 8,770
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 1 pt. 8,501
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 8,422
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 8,421
  7. Avatar for Columbia Univ CHEN 4800 Fall 2023 17. Columbia Univ CHEN 4800 Fall 2023 1 pt. 8,177
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,269
  2. Avatar for Galaxie 2. Galaxie Lv 1 60 pts. 10,258
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 33 pts. 10,219
  4. Avatar for alcor29 4. alcor29 Lv 1 17 pts. 10,196
  5. Avatar for hansvandenhof 5. hansvandenhof Lv 1 8 pts. 10,196
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 4 pts. 10,133
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 2 pts. 10,129
  8. Avatar for silent gene 8. silent gene Lv 1 1 pt. 10,103
  9. Avatar for Artoria2e5 9. Artoria2e5 Lv 1 1 pt. 9,883
  10. Avatar for jausmh 10. jausmh Lv 1 1 pt. 9,868

Comments

Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)