Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,285
  2. Avatar for Go Science 2. Go Science 73 pts. 10,133
  3. Avatar for Australia 3. Australia 52 pts. 10,009
  4. Avatar for Contenders 4. Contenders 36 pts. 9,970
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,907
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,819
  7. Avatar for VeFold 7. VeFold 10 pts. 9,784
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 9,612
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 9,603
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,485
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,285
  2. Avatar for sallallami 2. sallallami Lv 1 95 pts. 10,279
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 90 pts. 10,101
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 85 pts. 10,082
  5. Avatar for blazegeek 5. blazegeek Lv 1 80 pts. 10,078
  6. Avatar for SemperRabbit 6. SemperRabbit Lv 1 76 pts. 10,071
  7. Avatar for Galaxie 7. Galaxie Lv 1 71 pts. 10,052
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 67 pts. 10,036
  9. Avatar for hansvandenhof 9. hansvandenhof Lv 1 63 pts. 10,033
  10. Avatar for AlkiP0Ps 10. AlkiP0Ps Lv 1 60 pts. 10,009

Comments

Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)