Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,232
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,958
  3. Avatar for Belgium 13. Belgium 1 pt. 8,770
  4. Avatar for AlphaFold 15. AlphaFold 1 pt. 8,422

  1. Avatar for akaaka 11. akaaka Lv 1 56 pts. 10,005
  2. Avatar for gmn 12. gmn Lv 1 53 pts. 9,998
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 49 pts. 9,992
  4. Avatar for MicElephant 14. MicElephant Lv 1 46 pts. 9,970
  5. Avatar for Sandrix72 15. Sandrix72 Lv 1 43 pts. 9,921
  6. Avatar for fpc 16. fpc Lv 1 41 pts. 9,907
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 38 pts. 9,896
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 36 pts. 9,888
  9. Avatar for silent gene 19. silent gene Lv 1 33 pts. 9,859
  10. Avatar for Punzi Baker 3 20. Punzi Baker 3 Lv 1 31 pts. 9,834

Comments


Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)