Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,232
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,958
  3. Avatar for Belgium 13. Belgium 1 pt. 8,770
  4. Avatar for AlphaFold 15. AlphaFold 1 pt. 8,422

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 29 pts. 9,819
  2. Avatar for guineapig 22. guineapig Lv 1 27 pts. 9,796
  3. Avatar for g_b 23. g_b Lv 1 25 pts. 9,793
  4. Avatar for Hillbillie 24. Hillbillie Lv 1 23 pts. 9,784
  5. Avatar for georg137 25. georg137 Lv 1 22 pts. 9,753
  6. Avatar for alcor29 26. alcor29 Lv 1 20 pts. 9,752
  7. Avatar for BackBuffer 27. BackBuffer Lv 1 19 pts. 9,747
  8. Avatar for maithra 28. maithra Lv 1 17 pts. 9,733
  9. Avatar for roarshock 29. roarshock Lv 1 16 pts. 9,624
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 15 pts. 9,612

Comments


Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)