Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,232
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,958
  3. Avatar for Belgium 13. Belgium 1 pt. 8,770
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 1 pt. 8,501
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 8,422
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 8,421
  7. Avatar for Columbia Univ CHEN 4800 Fall 2023 17. Columbia Univ CHEN 4800 Fall 2023 1 pt. 8,177
  1. Avatar for AlphaFold2 71. AlphaFold2 Lv 1 1 pt. 8,422
  2. Avatar for nathanmills 72. nathanmills Lv 1 1 pt. 8,421
  3. Avatar for CAN1958 73. CAN1958 Lv 1 1 pt. 8,404
  4. Avatar for jdmclure 74. jdmclure Lv 1 1 pt. 8,389
  5. Avatar for KMnO4 75. KMnO4 Lv 1 1 pt. 8,385
  6. Avatar for rezaefar 76. rezaefar Lv 1 1 pt. 8,385
  7. Avatar for adamgillison 77. adamgillison Lv 1 1 pt. 8,317
  8. Avatar for TacticalToad 78. TacticalToad Lv 1 1 pt. 8,227
  9. Avatar for ProfVince 79. ProfVince Lv 1 1 pt. 8,187
  10. Avatar for alematics 80. alematics Lv 1 1 pt. 8,180

Comments

Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)