Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,285
  2. Avatar for Go Science 2. Go Science 73 pts. 10,133
  3. Avatar for Australia 3. Australia 52 pts. 10,009
  4. Avatar for Contenders 4. Contenders 36 pts. 9,970
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,907
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,819
  7. Avatar for VeFold 7. VeFold 10 pts. 9,784
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 9,612
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 9,603
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,485

  1. Avatar for AlphaFold2 71. AlphaFold2 Lv 1 1 pt. 8,422
  2. Avatar for nathanmills 72. nathanmills Lv 1 1 pt. 8,421
  3. Avatar for CAN1958 73. CAN1958 Lv 1 1 pt. 8,404
  4. Avatar for jdmclure 74. jdmclure Lv 1 1 pt. 8,389
  5. Avatar for KMnO4 75. KMnO4 Lv 1 1 pt. 8,385
  6. Avatar for rezaefar 76. rezaefar Lv 1 1 pt. 8,385
  7. Avatar for adamgillison 77. adamgillison Lv 1 1 pt. 8,317
  8. Avatar for TacticalToad 78. TacticalToad Lv 1 1 pt. 8,227
  9. Avatar for ProfVince 79. ProfVince Lv 1 1 pt. 8,187
  10. Avatar for alematics 80. alematics Lv 1 1 pt. 8,180

Comments


Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)