Icon representing a puzzle

2355: Revisiting Puzzle 96: Collagen

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
September 21, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,285
  2. Avatar for Go Science 2. Go Science 73 pts. 10,133
  3. Avatar for Australia 3. Australia 52 pts. 10,009
  4. Avatar for Contenders 4. Contenders 36 pts. 9,970
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,907
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,819
  7. Avatar for VeFold 7. VeFold 10 pts. 9,784
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 9,612
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 9,603
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,485
  1. Avatar for Gonegirl 41. Gonegirl Lv 1 6 pts. 9,138
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 5 pts. 9,084
  3. Avatar for Oransche 43. Oransche Lv 1 5 pts. 9,065
  4. Avatar for Hellcat6 44. Hellcat6 Lv 1 4 pts. 9,061
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 4 pts. 9,002
  6. Avatar for jakeanderson 46. jakeanderson Lv 1 4 pts. 8,976
  7. Avatar for dizzywings 47. dizzywings Lv 1 3 pts. 8,974
  8. Avatar for vybi 48. vybi Lv 1 3 pts. 8,958
  9. Avatar for Arne Heessels 49. Arne Heessels Lv 1 3 pts. 8,937
  10. Avatar for zbp 50. zbp Lv 1 2 pts. 8,932

Comments

Artoria2e5 Lv 1

This puzzle is interesting – if you just use the band pattern with ideal, flat sheets, you will find that a flip is needed to get the disulfides to connect. But the "correct" (as in PDB-deposited, biological) solution to this puzzle actually has a pair of twisted sheets! Have fun trying to build that.

(Or maybe the biological solution isn't the best-scoring… Do whatever.)