Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups


  1. Avatar for FamilyBarmettler 11. FamilyBarmettler 1 pt. 17,390
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 17,343
  3. Avatar for Belgium 13. Belgium 1 pt. 17,150

  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 46 pts. 17,514
  2. Avatar for maithra 12. maithra Lv 1 42 pts. 17,512
  3. Avatar for fpc 13. fpc Lv 1 39 pts. 17,505
  4. Avatar for georg137 14. georg137 Lv 1 36 pts. 17,504
  5. Avatar for silent gene 15. silent gene Lv 1 33 pts. 17,502
  6. Avatar for blazegeek 16. blazegeek Lv 1 30 pts. 17,501
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 27 pts. 17,498
  8. Avatar for ichwilldiesennamen 18. ichwilldiesennamen Lv 1 25 pts. 17,497
  9. Avatar for AmphotericinB 19. AmphotericinB Lv 1 23 pts. 17,497
  10. Avatar for phi16 20. phi16 Lv 1 20 pts. 17,496

Comments