Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups

  1. Avatar for FamilyBarmettler 11. FamilyBarmettler 1 pt. 17,390
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 17,343
  3. Avatar for Belgium 13. Belgium 1 pt. 17,150
  1. Avatar for Hillbillie 41. Hillbillie Lv 1 2 pts. 17,315
  2. Avatar for zbp 42. zbp Lv 1 2 pts. 17,306
  3. Avatar for Trajan464 43. Trajan464 Lv 1 1 pt. 17,286
  4. Avatar for roarshock 44. roarshock Lv 1 1 pt. 17,286
  5. Avatar for RichGuilmain 45. RichGuilmain Lv 1 1 pt. 17,271
  6. Avatar for gdnskye 46. gdnskye Lv 1 1 pt. 17,257
  7. Avatar for Oransche 47. Oransche Lv 1 1 pt. 17,250
  8. Avatar for rezaefar 48. rezaefar Lv 1 1 pt. 17,212
  9. Avatar for pfirth 49. pfirth Lv 1 1 pt. 17,186
  10. Avatar for cjddig 50. cjddig Lv 1 1 pt. 17,167

Comments