Placeholder image of a protein
Icon representing a puzzle

2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups


  1. Avatar for FamilyBarmettler 11. FamilyBarmettler 1 pt. 17,390
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 17,343
  3. Avatar for Belgium 13. Belgium 1 pt. 17,150

  1. Avatar for Swapper242 61. Swapper242 Lv 1 1 pt. 17,007
  2. Avatar for osc 62. osc Lv 1 1 pt. 16,971
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 16,944
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 16,940
  5. Avatar for Arne Heessels 65. Arne Heessels Lv 1 1 pt. 16,929
  6. Avatar for Yechan Kwon 66. Yechan Kwon Lv 1 1 pt. 16,919
  7. Avatar for threedylan 67. threedylan Lv 1 1 pt. 16,902
  8. Avatar for unicchi0427 68. unicchi0427 Lv 1 1 pt. 16,737
  9. Avatar for blablasusu 69. blablasusu Lv 1 1 pt. 16,567
  10. Avatar for Gonegirl 70. Gonegirl Lv 1 1 pt. 14,181

Comments