2362: Electron Density Reconstruction 60

Closed since over 2 years ago

Summary

• Created: September 29, 2023
• Expires: October 12, 2023 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

• Sequence: MEKTRPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Top groups

• 11. FamilyBarmettler 1 pt. 17,390
• 12. BOINC@Poland 1 pt. 17,343
• 13. Belgium 1 pt. 17,150

Top soloists

• 71. Glist 1 pt. 14,181

Comments

[Artoria2e5]

ytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkilnsiqvmraqmnqiq

blastp against pdb says this is https://www.rcsb.org/structure/1F0M (1B4F also matches, but coverage and -meric status differ). Being a 23-year-old structure it makes sense be at least a little wrong.