Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 23,718
  2. Avatar for Belgium 12. Belgium 1 pt. 23,619
  3. Avatar for BC125 - G9 13. BC125 - G9 1 pt. 23,040
  4. Avatar for Carillo's Folderz 14. Carillo's Folderz 1 pt. 22,997
  5. Avatar for BC125G1 15. BC125G1 1 pt. 22,968
  6. Avatar for BinaryStar 16. BinaryStar 1 pt. 22,917
  7. Avatar for AlphaFold 17. AlphaFold 1 pt. 22,534
  8. Avatar for UPJ Biochem 25 18. UPJ Biochem 25 1 pt. 16,036
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 54 pts. 24,156
  2. Avatar for gmn 12. gmn Lv 1 51 pts. 24,135
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 47 pts. 24,124
  4. Avatar for hansvandenhof 14. hansvandenhof Lv 1 44 pts. 24,110
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 41 pts. 24,094
  6. Avatar for fpc 16. fpc Lv 1 38 pts. 24,084
  7. Avatar for phi16 17. phi16 Lv 1 36 pts. 24,042
  8. Avatar for BackBuffer 18. BackBuffer Lv 1 33 pts. 24,037
  9. Avatar for silent gene 19. silent gene Lv 1 31 pts. 24,036
  10. Avatar for akaaka 20. akaaka Lv 1 29 pts. 24,024

Comments