Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 54 pts. 24,156
  2. Avatar for gmn 12. gmn Lv 1 51 pts. 24,135
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 47 pts. 24,124
  4. Avatar for hansvandenhof 14. hansvandenhof Lv 1 44 pts. 24,110
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 41 pts. 24,094
  6. Avatar for fpc 16. fpc Lv 1 38 pts. 24,084
  7. Avatar for phi16 17. phi16 Lv 1 36 pts. 24,042
  8. Avatar for BackBuffer 18. BackBuffer Lv 1 33 pts. 24,037
  9. Avatar for silent gene 19. silent gene Lv 1 31 pts. 24,036
  10. Avatar for akaaka 20. akaaka Lv 1 29 pts. 24,024

Comments