Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 23,718
  2. Avatar for Belgium 12. Belgium 1 pt. 23,619
  3. Avatar for BC125 - G9 13. BC125 - G9 1 pt. 23,040
  4. Avatar for Carillo's Folderz 14. Carillo's Folderz 1 pt. 22,997
  5. Avatar for BC125G1 15. BC125G1 1 pt. 22,968
  6. Avatar for BinaryStar 16. BinaryStar 1 pt. 22,917
  7. Avatar for AlphaFold 17. AlphaFold 1 pt. 22,534
  8. Avatar for UPJ Biochem 25 18. UPJ Biochem 25 1 pt. 16,036
  1. Avatar for osc 71. osc Lv 1 1 pt. 22,875
  2. Avatar for lelzky 72. lelzky Lv 1 1 pt. 22,872
  3. Avatar for balgarot 73. balgarot Lv 1 1 pt. 22,869
  4. Avatar for ernie 74. ernie Lv 1 1 pt. 22,868
  5. Avatar for KMnO4 75. KMnO4 Lv 1 1 pt. 22,855
  6. Avatar for AlexBg 76. AlexBg Lv 1 1 pt. 22,851
  7. Avatar for nelsongabriel 77. nelsongabriel Lv 1 1 pt. 22,787
  8. Avatar for ssumpter 78. ssumpter Lv 1 1 pt. 22,737
  9. Avatar for furi0us 79. furi0us Lv 1 1 pt. 22,544
  10. Avatar for Dinosaur 80. Dinosaur Lv 1 1 pt. 22,536

Comments