Placeholder image of a protein
Icon representing a puzzle

2365: Electron Density Reconstruction 61

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a couple different protein chains in it, each repeated twice.

Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRGPPLPRPRVKGPPLPRPRV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 24,252
  2. Avatar for Go Science 2. Go Science 74 pts. 24,204
  3. Avatar for Contenders 3. Contenders 54 pts. 24,182
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 24,156
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 24,084
  6. Avatar for Australia 6. Australia 18 pts. 24,003
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 12 pts. 23,971
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 23,839
  9. Avatar for VeFold 9. VeFold 5 pts. 23,833
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 23,736
  1. Avatar for osc 71. osc Lv 1 1 pt. 22,875
  2. Avatar for lelzky 72. lelzky Lv 1 1 pt. 22,872
  3. Avatar for balgarot 73. balgarot Lv 1 1 pt. 22,869
  4. Avatar for ernie 74. ernie Lv 1 1 pt. 22,868
  5. Avatar for KMnO4 75. KMnO4 Lv 1 1 pt. 22,855
  6. Avatar for AlexBg 76. AlexBg Lv 1 1 pt. 22,851
  7. Avatar for nelsongabriel 77. nelsongabriel Lv 1 1 pt. 22,787
  8. Avatar for ssumpter 78. ssumpter Lv 1 1 pt. 22,737
  9. Avatar for furi0us 79. furi0us Lv 1 1 pt. 22,544
  10. Avatar for Dinosaur 80. Dinosaur Lv 1 1 pt. 22,536

Comments