Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 29,488
  2. Avatar for Contenders 2. Contenders 70 pts. 29,476
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 29,464
  4. Avatar for Go Science 4. Go Science 30 pts. 29,456
  5. Avatar for Australia 5. Australia 19 pts. 29,312
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 29,298
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 29,262
  8. Avatar for Czech National Team 8. Czech National Team 4 pts. 29,184
  9. Avatar for VeFold 9. VeFold 2 pts. 29,118
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 29,048
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 29,485
  2. Avatar for MicElephant 2. MicElephant Lv 1 94 pts. 29,475
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 88 pts. 29,464
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 29,456
  5. Avatar for Galaxie 5. Galaxie Lv 1 77 pts. 29,443
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 71 pts. 29,424
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 66 pts. 29,422
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 62 pts. 29,420
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 57 pts. 29,418
  10. Avatar for guineapig 10. guineapig Lv 1 53 pts. 29,401

Comments