Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 29,488
  2. Avatar for LociOiling 2. LociOiling Lv 1 70 pts. 29,484
  3. Avatar for MicElephant 3. MicElephant Lv 1 47 pts. 29,476
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 30 pts. 29,469
  5. Avatar for gmn 5. gmn Lv 1 19 pts. 29,458
  6. Avatar for phi16 6. phi16 Lv 1 11 pts. 29,456
  7. Avatar for silent gene 7. silent gene Lv 1 7 pts. 29,451
  8. Avatar for guineapig 8. guineapig Lv 1 4 pts. 29,436
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 2 pts. 29,417
  10. Avatar for SemperRabbit 10. SemperRabbit Lv 1 1 pt. 29,413

Comments