Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 29,485
  2. Avatar for MicElephant 2. MicElephant Lv 1 94 pts. 29,475
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 88 pts. 29,464
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 29,456
  5. Avatar for Galaxie 5. Galaxie Lv 1 77 pts. 29,443
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 71 pts. 29,424
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 66 pts. 29,422
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 62 pts. 29,420
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 57 pts. 29,418
  10. Avatar for guineapig 10. guineapig Lv 1 53 pts. 29,401

Comments