Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for blazegeek 11. blazegeek Lv 1 49 pts. 29,400
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 46 pts. 29,389
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 42 pts. 29,355
  4. Avatar for gmn 14. gmn Lv 1 39 pts. 29,348
  5. Avatar for BackBuffer 15. BackBuffer Lv 1 36 pts. 29,336
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 33 pts. 29,312
  7. Avatar for alcor29 17. alcor29 Lv 1 31 pts. 29,309
  8. Avatar for SemperRabbit 18. SemperRabbit Lv 1 28 pts. 29,305
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 26 pts. 29,298
  10. Avatar for phi16 20. phi16 Lv 1 24 pts. 29,296

Comments