Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for akaaka 21. akaaka Lv 1 22 pts. 29,290
  2. Avatar for spvincent 22. spvincent Lv 1 20 pts. 29,285
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 18 pts. 29,276
  4. Avatar for fpc 24. fpc Lv 1 17 pts. 29,262
  5. Avatar for georg137 25. georg137 Lv 1 15 pts. 29,260
  6. Avatar for ichwilldiesennamen 26. ichwilldiesennamen Lv 1 14 pts. 29,244
  7. Avatar for hansvandenhof 27. hansvandenhof Lv 1 12 pts. 29,197
  8. Avatar for silent gene 28. silent gene Lv 1 11 pts. 29,196
  9. Avatar for vybi 29. vybi Lv 1 10 pts. 29,184
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 9 pts. 29,157

Comments