Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for Hillbillie 31. Hillbillie Lv 1 8 pts. 29,118
  2. Avatar for Joanna_H 32. Joanna_H Lv 1 7 pts. 29,048
  3. Avatar for Trajan464 33. Trajan464 Lv 1 7 pts. 29,025
  4. Avatar for ProfVince 34. ProfVince Lv 1 6 pts. 28,977
  5. Avatar for MirsadaH 35. MirsadaH Lv 1 5 pts. 28,947
  6. Avatar for maithra 36. maithra Lv 1 5 pts. 28,945
  7. Avatar for jausmh 37. jausmh Lv 1 4 pts. 28,853
  8. Avatar for AmphotericinB 38. AmphotericinB Lv 1 4 pts. 28,786
  9. Avatar for AlphaFold2 39. AlphaFold2 Lv 1 3 pts. 28,772
  10. Avatar for Larini 40. Larini Lv 1 3 pts. 28,769

Comments