Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for Opelgang 41. Opelgang Lv 1 3 pts. 28,705
  2. Avatar for zbp 42. zbp Lv 1 2 pts. 28,653
  3. Avatar for maralusg 43. maralusg Lv 1 2 pts. 28,557
  4. Avatar for rezaefar 44. rezaefar Lv 1 2 pts. 28,551
  5. Avatar for Deleted player 45. Deleted player 2 pts. 28,484
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 2 pts. 28,330
  7. Avatar for Merf 47. Merf Lv 1 2 pts. 28,299
  8. Avatar for Oransche 48. Oransche Lv 1 1 pt. 28,286
  9. Avatar for balgarot 49. balgarot Lv 1 1 pt. 28,170
  10. Avatar for Vinara 50. Vinara Lv 1 1 pt. 28,104

Comments