Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 28,947
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 28,772
  3. Avatar for Group3_BC180 13. Group3_BC180 1 pt. 28,557
  4. Avatar for Belgium 14. Belgium 1 pt. 28,484
  5. Avatar for BC125G1 15. BC125G1 1 pt. 27,703
  1. Avatar for diethyl_azodicarboxylate 71. diethyl_azodicarboxylate Lv 1 1 pt. 26,889
  2. Avatar for lnmllmnl 72. lnmllmnl Lv 1 1 pt. 23,985
  3. Avatar for suntl 73. suntl Lv 1 1 pt. 20,688
  4. Avatar for sjiang29 74. sjiang29 Lv 1 1 pt. 20,177
  5. Avatar for Katerina007 75. Katerina007 Lv 1 1 pt. 20,177
  6. Avatar for Gematron 2874 76. Gematron 2874 Lv 1 1 pt. 20,177
  7. Avatar for Peng Gevin 77. Peng Gevin Lv 1 1 pt. 20,177

Comments