Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 29,488
  2. Avatar for Contenders 2. Contenders 70 pts. 29,476
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 29,464
  4. Avatar for Go Science 4. Go Science 30 pts. 29,456
  5. Avatar for Australia 5. Australia 19 pts. 29,312
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 29,298
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 29,262
  8. Avatar for Czech National Team 8. Czech National Team 4 pts. 29,184
  9. Avatar for VeFold 9. VeFold 2 pts. 29,118
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 29,048

  1. Avatar for alcor29 11. alcor29 Lv 1 1 pt. 29,411
  2. Avatar for jausmh 12. jausmh Lv 1 1 pt. 29,258
  3. Avatar for maithra 13. maithra Lv 1 1 pt. 29,254
  4. Avatar for georg137 14. georg137 Lv 1 1 pt. 29,252
  5. Avatar for Oransche 15. Oransche Lv 1 1 pt. 29,197

Comments