Placeholder image of a protein
Icon representing a puzzle

2368: Electron Density Reconstruction 62

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 29, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle.

Sequence
MKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTSHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 29,488
  2. Avatar for Contenders 2. Contenders 70 pts. 29,476
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 29,464
  4. Avatar for Go Science 4. Go Science 30 pts. 29,456
  5. Avatar for Australia 5. Australia 19 pts. 29,312
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 29,298
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 29,262
  8. Avatar for Czech National Team 8. Czech National Team 4 pts. 29,184
  9. Avatar for VeFold 9. VeFold 2 pts. 29,118
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 29,048

  1. Avatar for Opelgang 41. Opelgang Lv 1 3 pts. 28,705
  2. Avatar for zbp 42. zbp Lv 1 2 pts. 28,653
  3. Avatar for maralusg 43. maralusg Lv 1 2 pts. 28,557
  4. Avatar for rezaefar 44. rezaefar Lv 1 2 pts. 28,551
  5. Avatar for Deleted player 45. Deleted player 2 pts. 28,484
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 2 pts. 28,330
  7. Avatar for Merf 47. Merf Lv 1 2 pts. 28,299
  8. Avatar for Oransche 48. Oransche Lv 1 1 pt. 28,286
  9. Avatar for balgarot 49. balgarot Lv 1 1 pt. 28,170
  10. Avatar for Vinara 50. Vinara Lv 1 1 pt. 28,104

Comments