Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,800
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,683
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,660
  4. Avatar for Belgium 14. Belgium 1 pt. 8,532

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,249
  2. Avatar for BackBuffer 2. BackBuffer Lv 1 94 pts. 9,234
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 88 pts. 9,215
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 82 pts. 9,199
  5. Avatar for blazegeek 5. blazegeek Lv 1 76 pts. 9,173
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 71 pts. 9,160
  7. Avatar for fpc 7. fpc Lv 1 66 pts. 9,158
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 61 pts. 9,157
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 57 pts. 9,157
  10. Avatar for Galaxie 10. Galaxie Lv 1 53 pts. 9,154

Comments