Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,249
  2. Avatar for Contenders 2. Contenders 70 pts. 9,215
  3. Avatar for Go Science 3. Go Science 47 pts. 9,212
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,158
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 9,139
  6. Avatar for VeFold 6. VeFold 11 pts. 9,103
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 9,095
  8. Avatar for Australia 8. Australia 4 pts. 9,011
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 8,983
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 8,944

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,249
  2. Avatar for BackBuffer 2. BackBuffer Lv 1 94 pts. 9,234
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 88 pts. 9,215
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 82 pts. 9,199
  5. Avatar for blazegeek 5. blazegeek Lv 1 76 pts. 9,173
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 71 pts. 9,160
  7. Avatar for fpc 7. fpc Lv 1 66 pts. 9,158
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 61 pts. 9,157
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 57 pts. 9,157
  10. Avatar for Galaxie 10. Galaxie Lv 1 53 pts. 9,154

Comments