Icon representing a puzzle

2361: Revisiting Puzzle 109: Pumpkin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
October 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,800
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,683
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,660
  4. Avatar for Belgium 14. Belgium 1 pt. 8,532
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 7,747
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,248
  2. Avatar for Galaxie 2. Galaxie Lv 1 65 pts. 9,245
  3. Avatar for phi16 3. phi16 Lv 1 41 pts. 9,236
  4. Avatar for gdnskye 4. gdnskye Lv 1 24 pts. 9,235
  5. Avatar for alcor29 5. alcor29 Lv 1 14 pts. 9,227
  6. Avatar for SemperRabbit 6. SemperRabbit Lv 1 7 pts. 9,226
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 4 pts. 9,212
  8. Avatar for MicElephant 8. MicElephant Lv 1 2 pts. 9,202
  9. Avatar for maithra 9. maithra Lv 1 1 pt. 9,189
  10. Avatar for silent gene 10. silent gene Lv 1 1 pt. 9,131

Comments