Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 26,868
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 26,688
  3. Avatar for 202302 13. 202302 1 pt. 26,445
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 26,380
  1. Avatar for guineapig 11. guineapig Lv 1 47 pts. 27,129
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 43 pts. 27,129
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 40 pts. 27,128
  4. Avatar for blazegeek 14. blazegeek Lv 1 36 pts. 27,112
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 33 pts. 27,108
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 30 pts. 27,106
  7. Avatar for alcor29 17. alcor29 Lv 1 28 pts. 27,104
  8. Avatar for maithra 18. maithra Lv 1 25 pts. 27,102
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 23 pts. 27,101
  10. Avatar for akaaka 20. akaaka Lv 1 21 pts. 27,098

Comments