Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 26,868
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 26,688
  3. Avatar for 202302 13. 202302 1 pt. 26,445
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 26,380
  1. Avatar for vybi 21. vybi Lv 1 19 pts. 27,088
  2. Avatar for jausmh 22. jausmh Lv 1 17 pts. 27,080
  3. Avatar for georg137 23. georg137 Lv 1 16 pts. 27,071
  4. Avatar for silent gene 24. silent gene Lv 1 14 pts. 27,064
  5. Avatar for Joanna_H 25. Joanna_H Lv 1 13 pts. 27,063
  6. Avatar for spvincent 26. spvincent Lv 1 11 pts. 27,052
  7. Avatar for Steven Pletsch 27. Steven Pletsch Lv 1 10 pts. 27,050
  8. Avatar for ichwilldiesennamen 28. ichwilldiesennamen Lv 1 9 pts. 27,038
  9. Avatar for hansvandenhof 29. hansvandenhof Lv 1 8 pts. 27,036
  10. Avatar for Hillbillie 30. Hillbillie Lv 1 7 pts. 27,028

Comments