Placeholder image of a protein
Icon representing a puzzle

2374: Electron Density Reconstruction 64

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
October 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 26,868
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 26,688
  3. Avatar for 202302 13. 202302 1 pt. 26,445
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 26,380
  1. Avatar for Trajan464 41. Trajan464 Lv 1 2 pts. 26,889
  2. Avatar for ShadowTactics 42. ShadowTactics Lv 1 2 pts. 26,879
  3. Avatar for Deleted player 43. Deleted player 2 pts. 26,868
  4. Avatar for phi16 44. phi16 Lv 1 2 pts. 26,863
  5. Avatar for Opelgang 45. Opelgang Lv 1 1 pt. 26,832
  6. Avatar for mengzach 46. mengzach Lv 1 1 pt. 26,765
  7. Avatar for pfirth 47. pfirth Lv 1 1 pt. 26,761
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 1 pt. 26,757
  9. Avatar for Hellcat6 49. Hellcat6 Lv 1 1 pt. 26,733
  10. Avatar for vuvuvu 50. vuvuvu Lv 1 1 pt. 26,688

Comments