2374: Electron Density Reconstruction 64
Closed since over 2 years ago
Novice Novice Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- October 11, 2023
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.
- Sequence
- MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS
