Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for 202302 11. 202302 1 pt. 10,043
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,955
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,760
  4. Avatar for Belgium 14. Belgium 1 pt. 9,441
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,917
  6. Avatar for Window Group 16. Window Group 1 pt. 7,465

  1. Avatar for silent gene 21. silent gene Lv 1 29 pts. 10,631
  2. Avatar for roarshock 22. roarshock Lv 1 27 pts. 10,606
  3. Avatar for AlkiP0Ps 23. AlkiP0Ps Lv 1 26 pts. 10,602
  4. Avatar for phi16 24. phi16 Lv 1 24 pts. 10,599
  5. Avatar for Hillbillie 25. Hillbillie Lv 1 22 pts. 10,589
  6. Avatar for hansvandenhof 26. hansvandenhof Lv 1 21 pts. 10,577
  7. Avatar for georg137 27. georg137 Lv 1 19 pts. 10,536
  8. Avatar for maithra 28. maithra Lv 1 18 pts. 10,526
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 16 pts. 10,519
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 15 pts. 10,491

Comments