Icon representing a puzzle

2373: Revisiting Puzzle 113: White Birch

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,898
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,895
  3. Avatar for Contenders 3. Contenders 49 pts. 10,823
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,687
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,679
  6. Avatar for Australia 6. Australia 14 pts. 10,602
  7. Avatar for VeFold 7. VeFold 8 pts. 10,589
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,519
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 10,491
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,380
  1. Avatar for silent gene 21. silent gene Lv 1 29 pts. 10,631
  2. Avatar for roarshock 22. roarshock Lv 1 27 pts. 10,606
  3. Avatar for AlkiP0Ps 23. AlkiP0Ps Lv 1 26 pts. 10,602
  4. Avatar for phi16 24. phi16 Lv 1 24 pts. 10,599
  5. Avatar for Hillbillie 25. Hillbillie Lv 1 22 pts. 10,589
  6. Avatar for hansvandenhof 26. hansvandenhof Lv 1 21 pts. 10,577
  7. Avatar for georg137 27. georg137 Lv 1 19 pts. 10,536
  8. Avatar for maithra 28. maithra Lv 1 18 pts. 10,526
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 16 pts. 10,519
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 15 pts. 10,491

Comments