Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 10,008
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,491
  3. Avatar for 202302 13. 202302 1 pt. 9,305
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 8,465
  1. Avatar for gmn 11. gmn Lv 1 54 pts. 11,120
  2. Avatar for Joanna_H 12. Joanna_H Lv 1 50 pts. 11,115
  3. Avatar for BackBuffer 13. BackBuffer Lv 1 47 pts. 11,096
  4. Avatar for Galaxie 14. Galaxie Lv 1 44 pts. 11,091
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 41 pts. 11,055
  6. Avatar for maithra 16. maithra Lv 1 38 pts. 11,054
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 35 pts. 11,053
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 33 pts. 11,049
  9. Avatar for g_b 19. g_b Lv 1 30 pts. 11,026
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 28 pts. 10,965

Comments