Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,327
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,256
  3. Avatar for Contenders 3. Contenders 44 pts. 11,255
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 11,115
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,053
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,965
  7. Avatar for Australia 7. Australia 5 pts. 10,954
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 10,926
  9. Avatar for VeFold 9. VeFold 1 pt. 10,655
  10. Avatar for Ukraine 10. Ukraine 1 pt. 10,425
  1. Avatar for gmn 11. gmn Lv 1 54 pts. 11,120
  2. Avatar for Joanna_H 12. Joanna_H Lv 1 50 pts. 11,115
  3. Avatar for BackBuffer 13. BackBuffer Lv 1 47 pts. 11,096
  4. Avatar for Galaxie 14. Galaxie Lv 1 44 pts. 11,091
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 41 pts. 11,055
  6. Avatar for maithra 16. maithra Lv 1 38 pts. 11,054
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 35 pts. 11,053
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 33 pts. 11,049
  9. Avatar for g_b 19. g_b Lv 1 30 pts. 11,026
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 28 pts. 10,965

Comments