Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 10,008
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,491
  3. Avatar for 202302 13. 202302 1 pt. 9,305
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 1 pt. 8,465

  1. Avatar for vybi 41. vybi Lv 1 4 pts. 10,162
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 4 pts. 10,022
  3. Avatar for Deleted player 43. Deleted player 4 pts. 10,008
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 3 pts. 10,000
  5. Avatar for DScott 45. DScott Lv 1 3 pts. 9,949
  6. Avatar for jamestpierce 46. jamestpierce Lv 1 3 pts. 9,918
  7. Avatar for koolcoder101 47. koolcoder101 Lv 1 2 pts. 9,895
  8. Avatar for Merf 48. Merf Lv 1 2 pts. 9,870
  9. Avatar for zbp 49. zbp Lv 1 2 pts. 9,830
  10. Avatar for pfirth 50. pfirth Lv 1 2 pts. 9,749

Comments