Icon representing a puzzle

2376: Revisiting Puzzle 114: Black Mamba

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,327
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,256
  3. Avatar for Contenders 3. Contenders 44 pts. 11,255
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 11,115
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,053
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,965
  7. Avatar for Australia 7. Australia 5 pts. 10,954
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 10,926
  9. Avatar for VeFold 9. VeFold 1 pt. 10,655
  10. Avatar for Ukraine 10. Ukraine 1 pt. 10,425
  1. Avatar for vybi 41. vybi Lv 1 4 pts. 10,162
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 4 pts. 10,022
  3. Avatar for Deleted player 43. Deleted player 4 pts. 10,008
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 3 pts. 10,000
  5. Avatar for DScott 45. DScott Lv 1 3 pts. 9,949
  6. Avatar for jamestpierce 46. jamestpierce Lv 1 3 pts. 9,918
  7. Avatar for koolcoder101 47. koolcoder101 Lv 1 2 pts. 9,895
  8. Avatar for Merf 48. Merf Lv 1 2 pts. 9,870
  9. Avatar for zbp 49. zbp Lv 1 2 pts. 9,830
  10. Avatar for pfirth 50. pfirth Lv 1 2 pts. 9,749

Comments