Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Ukraine 11. Ukraine 1 pt. 10,155
  2. Avatar for Belgium 12. Belgium 1 pt. 10,030
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,000
  4. Avatar for Team China 14. Team China 1 pt. 9,983
  5. Avatar for 202302 15. 202302 1 pt. 9,662
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 9,510

  1. Avatar for Galaxie 11. Galaxie Lv 1 53 pts. 11,016
  2. Avatar for BackBuffer 12. BackBuffer Lv 1 49 pts. 11,011
  3. Avatar for g_b 13. g_b Lv 1 46 pts. 11,008
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 43 pts. 11,007
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 40 pts. 10,988
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 37 pts. 10,985
  7. Avatar for blazegeek 17. blazegeek Lv 1 34 pts. 10,969
  8. Avatar for MicElephant 18. MicElephant Lv 1 32 pts. 10,962
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 29 pts. 10,952
  10. Avatar for Merf 20. Merf Lv 1 27 pts. 10,939

Comments