Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,222
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,155
  3. Avatar for Australia 3. Australia 49 pts. 11,021
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 33 pts. 11,007
  5. Avatar for Contenders 5. Contenders 22 pts. 10,988
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,952
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,911
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,877
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,567
  10. Avatar for VeFold 10. VeFold 2 pts. 10,395
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 11,222
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 95 pts. 11,174
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 11,163
  4. Avatar for LociOiling 4. LociOiling Lv 1 83 pts. 11,155
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 78 pts. 11,107
  6. Avatar for akaaka 6. akaaka Lv 1 74 pts. 11,081
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 69 pts. 11,064
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 65 pts. 11,062
  9. Avatar for gmn 9. gmn Lv 1 60 pts. 11,039
  10. Avatar for AlkiP0Ps 10. AlkiP0Ps Lv 1 56 pts. 11,021

Comments