Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Ukraine 11. Ukraine 1 pt. 10,155
  2. Avatar for Belgium 12. Belgium 1 pt. 10,030
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,000
  4. Avatar for Team China 14. Team China 1 pt. 9,983
  5. Avatar for 202302 15. 202302 1 pt. 9,662
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 9,510
  1. Avatar for Steven Pletsch 31. Steven Pletsch Lv 1 11 pts. 10,604
  2. Avatar for Larini 32. Larini Lv 1 10 pts. 10,577
  3. Avatar for vybi 33. vybi Lv 1 9 pts. 10,568
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 8 pts. 10,567
  5. Avatar for Guido 35. Guido Lv 1 7 pts. 10,563
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 7 pts. 10,561
  7. Avatar for ecali 37. ecali Lv 1 6 pts. 10,559
  8. Avatar for alcor29 38. alcor29 Lv 1 5 pts. 10,542
  9. Avatar for maithra 39. maithra Lv 1 5 pts. 10,490
  10. Avatar for jamestpierce 40. jamestpierce Lv 1 4 pts. 10,447

Comments