Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Ukraine 11. Ukraine 1 pt. 10,155
  2. Avatar for Belgium 12. Belgium 1 pt. 10,030
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,000
  4. Avatar for Team China 14. Team China 1 pt. 9,983
  5. Avatar for 202302 15. 202302 1 pt. 9,662
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 9,510
  1. Avatar for Opelgang 51. Opelgang Lv 1 1 pt. 10,063
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 10,048
  3. Avatar for ProfVince 53. ProfVince Lv 1 1 pt. 10,030
  4. Avatar for Deleted player 54. Deleted player pts. 10,030
  5. Avatar for Alistair69 55. Alistair69 Lv 1 1 pt. 10,022
  6. Avatar for vuvuvu 56. vuvuvu Lv 1 1 pt. 10,000
  7. Avatar for zo3xiaJonWeinberg 57. zo3xiaJonWeinberg Lv 1 1 pt. 9,983
  8. Avatar for Oransche 58. Oransche Lv 1 1 pt. 9,976
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 9,965
  10. Avatar for Th1sN@me!sN0tAPun 60. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,907

Comments