Icon representing a puzzle

2379: Revisiting Puzzle 115: Exocyst

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Ukraine 11. Ukraine 1 pt. 10,155
  2. Avatar for Belgium 12. Belgium 1 pt. 10,030
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,000
  4. Avatar for Team China 14. Team China 1 pt. 9,983
  5. Avatar for 202302 15. 202302 1 pt. 9,662
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 9,510

  1. Avatar for AlphaFold2 71. AlphaFold2 Lv 1 1 pt. 9,510
  2. Avatar for pruneau_44 72. pruneau_44 Lv 1 1 pt. 9,489
  3. Avatar for harvardman 73. harvardman Lv 1 1 pt. 9,469
  4. Avatar for osc 74. osc Lv 1 1 pt. 9,384
  5. Avatar for Yechan Kwon 75. Yechan Kwon Lv 1 1 pt. 9,370
  6. Avatar for furi0us 76. furi0us Lv 1 1 pt. 9,363
  7. Avatar for Cavalier 77. Cavalier Lv 1 1 pt. 8,839
  8. Avatar for Joshuanadzo3 78. Joshuanadzo3 Lv 1 1 pt. 8,557
  9. Avatar for chairuitong 79. chairuitong Lv 1 1 pt. 8,164
  10. Avatar for The Nephrons 80. The Nephrons Lv 1 1 pt. 8,147

Comments